@article{fdi:010069943,
  title = {{M}odulation of {HIV} binding to epithelial cells and {HIV} transfer from immature dendritic cells to {CD}4 {T} lymphocytes by human lactoferrin and its major exposed {LF}-33 peptide},
  author = {{C}arthagena, {L}. and {B}ecquart, {P}ierre and {H}ocini, {H}. and {K}azatchkine, {M}.{D}. and {B}ouhlala, {H}. and {B}elec, {L}.},
  editor = {},
  language = {{ENG}},
  abstract = {{L}actoferrin ({LF}), a multifunctional molecule present in human secretions, has potent inhibitory activities against human immunodeficiency virus ({HIV}). {T}he aim of the study was to evaluate whether human {LF} (h{LF}) and its exposed domain {LF}-33 represented by the peptide ({LF}-33-{GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGP}) involved in {LF}-{HIV} gag binding and endotoxines neutralization, may inhibit early steps of {HIV} mucosal transmission. {H}uman {LF} and the peptide {LF}-33 inhibited the attachment of primary {X}4-tropic {HIV}-1{NDK} and {R}5-tropic {HIV}-1{JR}-{CSF} strains to human endometrial ({HEC}-1) and colorectal ({HT}-29) {CD}4-negative epithelial cells, the purified h{LF} being more potent (up to 80%) than the {LF}-33 peptide. {I}n addition, the h{LF}, but not the {LF}-33 peptide, inhibited up to 40% the transfer in trans of {HIV}-1{JR}-{CSF} and {HIV}-1{NDK}, from immature dendritic cells to {CD}4 {T} lymphocytes, likely in a {DC}-{SIGN}-dependent manner. {A}ltogether, these findings demonstrate that h{LF} can interfere with {HIV}-1 mucosal transmission by blocking virus attachment to epithelial cells and by inhibiting virus transfer from dendritic cells to {CD}4 {T} cells, two crucial steps of {HIV} dissemination from mucosae to lymphoid tissue.},
  keywords = {},
  booktitle = {},
  journal = {{O}pen {V}irology {J}ournal},
  volume = {5},
  numero = {art. no {TOVJ}-5-27},
  pages = {27--34},
  ISSN = {1874-3579},
  year = {2011},
  DOI = {10.2174/1874357901105010027},
  URL = {https://www.documentation.ird.fr/hor/fdi:010069943},
}